PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002625
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family ARR-B
Protein Properties Length: 587aa    MW: 64483.5 Da    PI: 6.4615
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-55616PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.66.5e-29198251155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kpr++W+ +LH++Fv av+qL G+ekA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Lsa002625 198 KPRVVWSIDLHRKFVAAVNQL-GIEKAVPKRILDLMNVEGLTRENVASHLQKYRL 251
                79*******************.********************************8 PP

2Response_reg77.45e-26211291109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ ++ll  +l+k +y +v++++++  al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++++++++++ + +  Ga 
     Lsa002625  21 VLAVDDDPTCLKLLDGLLRKCQY-QVTTTSQAITALKMLRENRnrFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSGNSDPKLVMKGITHGAC 115
                   799********************.***************999889*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l+Kp+  eel++
     Lsa002625 116 DYLVKPVRLEELRN 129
                   ************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.6E-1591587IPR017053Response regulator B-type, plant
SuperFamilySSF521727.68E-3618143IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.7E-4218153No hitNo description
SMARTSM004489.3E-3219131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.0120135IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.0E-2321130IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.63E-2722135No hitNo description
Gene3DG3DSA:1.10.10.605.2E-30195256IPR009057Homeodomain-like
PROSITE profilePS5129411.276195254IPR017930Myb domain
SuperFamilySSF466895.73E-19196255IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-24198251IPR006447Myb domain, plants
PfamPF002491.4E-5200250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MTVEEIRGSN EIDRFPIGMR VLAVDDDPTC LKLLDGLLRK CQYQVTTTSQ AITALKMLRE  60
NRNRFDLVIS DVHMPDMDGF KLLELVGLEM DLPVIMLSGN SDPKLVMKGI THGACDYLVK  120
PVRLEELRNI WQHVIRRKVE SKSQSKSDNQ DRQNHGGEGG QEAGSGDLNG KLNRKRKDED  180
DDGEDNGNED DDPSSQKKPR VVWSIDLHRK FVAAVNQLGI EKAVPKRILD LMNVEGLTRE  240
NVASHLQKYR LYLKRISQQA NMVVAFGGSK DASSYMRMSS LEGLGDFRTL SASGRLPGPT  300
LSSYSPSGML GRLNSATGMT LHSLTSPSII QPTHTQNLTH SINSLNKFQP VVLPTPQTQT  360
HQNTNLFQSP FDLTHHKPNN NTQIPDFTPI DESRIFTGSL KMGSMSSESF NLVSSSSTFL  420
DVPIPPPIGD TFHDQLPPNG GLKYGYTAGF GSSNITTTAS VPLEVQSQRQ GQYGKQNYGQ  480
YSSNGFSTLS ASAPPLSGGC LGGNGALTTA PAMQHNRGSE RSSTELKMGP GQEYLLEHSK  540
ILNGFVANNG YDSLDDLMNG MMKREQDPTI IMDGEYGFDP YSFGSCI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-26194257164ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009795713.10.0PREDICTED: two-component response regulator ARR12-like
RefseqXP_016451611.10.0PREDICTED: two-component response regulator ARR12-like isoform X2
SwissprotB8B3I41e-132ORR22_ORYSI; Two-component response regulator ORR22
SwissprotQ5SML51e-132ORR22_ORYSJ; Two-component response regulator ORR22
TrEMBLA0A103XN080.0A0A103XN08_CYNCS; CheY-like superfamily
STRINGPGSC0003DMT4000202330.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-121response regulator 12